Lineage for d1xq9b_ (1xq9 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890965Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2890966Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2890967Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 2890977Protein Phosphoglycerate mutase [53256] (6 species)
  7. 2891011Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [117668] (1 PDB entry)
    Uniprot Q8IIG6
  8. 2891013Domain d1xq9b_: 1xq9 B: [115836]
    Other proteins in same PDB: d1xq9a2
    Structural genomics target
    complexed with scn

Details for d1xq9b_

PDB Entry: 1xq9 (more details), 2.58 Å

PDB Description: structure of phosphoglycerate mutase from plasmodium falciparum at 2.6 resolution
PDB Compounds: (B:) phosphoglycerate mutase

SCOPe Domain Sequences for d1xq9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xq9b_ c.60.1.1 (B:) Phosphoglycerate mutase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
ttytlvllrhgestwnkenkftgwtdvplsekgeeeaiaagkylkeknfkfdvvytsvlk
raictawnvlktadllhvpvvktwrlnerhygslqglnksetakkygeeqvkiwrrsydi
pppkldkednrwpghnvvyknvpkdalpfteclkdtvervlpfwfdhiapdilankkvmv
aahgnslrglvkhldnlseadvlelniptgvplvyeldenlkpikhyylldseelkkkmd

SCOPe Domain Coordinates for d1xq9b_:

Click to download the PDB-style file with coordinates for d1xq9b_.
(The format of our PDB-style files is described here.)

Timeline for d1xq9b_: