PDB entry 1xq9

View 1xq9 on RCSB PDB site
Description: Structure of Phosphoglycerate Mutase from Plasmodium falciparum at 2.6 Resolution
Class: structural genomics, unknown function
Keywords: Phosphoglycerate, PGAM, glycolysis, mutase, STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, Structural Genomics of Pathogenic Protozoa Consortium, SGPP, UNKNOWN FUNCTION
Deposited on 2004-10-11, released 2004-12-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglycerate mutase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • GB NP_701068 (8-End)
    Domains in SCOPe 2.08: d1xq9a1, d1xq9a2
  • Chain 'B':
    Compound: phosphoglycerate mutase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • GB NP_701068
    Domains in SCOPe 2.08: d1xq9b_
  • Heterogens: SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xq9A (A:)
    mahhhhhhmttytlvllrhgestwnkenkftgwtdvplsekgeeeaiaagkylkeknfkf
    dvvytsvlkraictawnvlktadllhvpvvktwrlnerhygslqglnksetakkygeeqv
    kiwrrsydipppkldkednrwpghnvvyknvpkdalpfteclkdtvervlpfwfdhiapd
    ilankkvmvaahgnslrglvkhldnlseadvlelniptgvplvyeldenlkpikhyylld
    seelkkkmdevanqgkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xq9A (A:)
    mttytlvllrhgestwnkenkftgwtdvplsekgeeeaiaagkylkeknfkfdvvytsvl
    kraictawnvlktadllhvpvvktwrlnerhygslqglnksetakkygeeqvkiwrrsyd
    ipppkldkednrwpghnvvyknvpkdalpfteclkdtvervlpfwfdhiapdilankkvm
    vaahgnslrglvkhldnlseadvlelniptgvplvyeldenlkpikhyylldseelkkkm
    d
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xq9B (B:)
    mahhhhhhmttytlvllrhgestwnkenkftgwtdvplsekgeeeaiaagkylkeknfkf
    dvvytsvlkraictawnvlktadllhvpvvktwrlnerhygslqglnksetakkygeeqv
    kiwrrsydipppkldkednrwpghnvvyknvpkdalpfteclkdtvervlpfwfdhiapd
    ilankkvmvaahgnslrglvkhldnlseadvlelniptgvplvyeldenlkpikhyylld
    seelkkkmdevanqgkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xq9B (B:)
    ttytlvllrhgestwnkenkftgwtdvplsekgeeeaiaagkylkeknfkfdvvytsvlk
    raictawnvlktadllhvpvvktwrlnerhygslqglnksetakkygeeqvkiwrrsydi
    pppkldkednrwpghnvvyknvpkdalpfteclkdtvervlpfwfdhiapdilankkvmv
    aahgnslrglvkhldnlseadvlelniptgvplvyeldenlkpikhyylldseelkkkmd