Lineage for d1xq9b_ (1xq9 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 588092Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 588093Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families) (S)
  5. 588094Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (3 proteins)
  6. 588104Protein Phosphoglycerate mutase [53256] (6 species)
  7. 588140Species Plasmodium falciparum [117668] (1 PDB entry)
  8. 588142Domain d1xq9b_: 1xq9 B: [115836]
    Structural genomics target
    complexed with scn

Details for d1xq9b_

PDB Entry: 1xq9 (more details), 2.58 Å

PDB Description: structure of phosphoglycerate mutase from plasmodium falciparum at 2.6 resolution

SCOP Domain Sequences for d1xq9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xq9b_ c.60.1.1 (B:) Phosphoglycerate mutase {Plasmodium falciparum}
ttytlvllrhgestwnkenkftgwtdvplsekgeeeaiaagkylkeknfkfdvvytsvlk
raictawnvlktadllhvpvvktwrlnerhygslqglnksetakkygeeqvkiwrrsydi
pppkldkednrwpghnvvyknvpkdalpfteclkdtvervlpfwfdhiapdilankkvmv
aahgnslrglvkhldnlseadvlelniptgvplvyeldenlkpikhyylldseelkkkmd

SCOP Domain Coordinates for d1xq9b_:

Click to download the PDB-style file with coordinates for d1xq9b_.
(The format of our PDB-style files is described here.)

Timeline for d1xq9b_: