Lineage for d1xq6a_ (1xq6 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1346668Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1347545Protein Hypothetical protein At5g02240 (T7H20_290) [117417] (1 species)
  7. 1347546Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117418] (4 PDB entries)
    Uniprot Q94EG6
  8. 1347549Domain d1xq6a_: 1xq6 A: [115829]
    Structural genomics target
    complexed with nap

Details for d1xq6a_

PDB Entry: 1xq6 (more details), 1.8 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at5g02240
PDB Compounds: (A:) unknown protein

SCOPe Domain Sequences for d1xq6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xq6a_ c.2.1.2 (A:) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sanlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditda
dsinpafqgidalviltsavpkmkpgfdptkggrpefifedgqypeqvdwigqknqidaa
kvagvkhivvvgsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldk
eggvrellvgkddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptk
dfkalfsqvtsrf

SCOPe Domain Coordinates for d1xq6a_:

Click to download the PDB-style file with coordinates for d1xq6a_.
(The format of our PDB-style files is described here.)

Timeline for d1xq6a_: