SCOPe 2.08: Domain d1xq6a1: 1xq6 A:2-253

Lineage for d1xq6a1 (1xq6 A:2-253)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein Hypothetical protein At5g02240 (T7H20_290) [117417] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117418] (4 PDB entries)
   Uniprot Q94EG6

8. Domain d1xq6a1: 1xq6 A:2-253 [115829]
   Other proteins in same PDB: d1xq6a2, d1xq6b2
   Structural genomics target
   complexed with nap

Details for d1xq6a1

PDB Entry: 1xq6, 1.8 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at5g02240

PDB Compounds: (A:) unknown protein

SCOPe Domain Sequences for d1xq6a1:

Sequence; same for both SEQRES and ATOM records:

>d1xq6a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
anlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditdad
sinpafqgidalviltsavpkmkpgfdptkggrpefifedgqypeqvdwigqknqidaak
vagvkhivvvgsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldke
ggvrellvgkddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptkd
fkalfsqvtsrf

Timeline for d1xq6a1:

• d1xq6a1 first appeared in SCOP 1.71, called d1xq6a_
  
• d1xq6a1 appears in SCOPe 2.07