SCOPe 2.08: Domain d1xoua_: 1xou A:

Lineage for d1xoua_ (1xou A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.231: EspA/CesA-like [116926] (1 superfamily)
   4 helices; bundle, closed, left ight-handed twist; interlocked (hetero)dimer of 2-helical subunits

4. Superfamily a.231.1: EspA/CesA-like [116927] (2 families)
   secreted protein and its chaperone both adopt similar substructures in the heterodimer

5. Family a.231.1.1: EspA-like [116928] (1 protein)
   Pfam PF03433

6. Protein Secreted protein EspA [116929] (1 species)

7. Species Escherichia coli [TaxId:562] [116930] (1 PDB entry)
   Uniprot Q47184 31-190

8. Domain d1xoua_: 1xou A: [115715]
   Other proteins in same PDB: d1xoub_

Details for d1xoua_

PDB Entry: 1xou, 2.8 Å

PDB Description: crystal structure of the cesa-espa complex

PDB Compounds: (A:) EspA

SCOPe Domain Sequences for d1xoua_:

Sequence, based on SEQRES records:

>d1xoua_ a.231.1.1 (A:) Secreted protein EspA {Escherichia coli [TaxId: 562]}
dvidlfnklgvfqaailmfaymyqaqsdlsiakfadmneaskesttaqkmanlvdakiad
vqsssdknakaqlpdevisyindprnditisgidninaqlgagdlqtvkaaisakannlt
ttvnnsqleiqqmsntlnlltsarsdmqslqyrtisgisl

Sequence, based on observed residues (ATOM records):

>d1xoua_ a.231.1.1 (A:) Secreted protein EspA {Escherichia coli [TaxId: 562]}
dvidlfnklgvfqaailmfaymyqaqsdlnltttvnnsqleiqqmsntlnlltsarsdmq
slqyrtisgisl

Timeline for d1xoua_:

• d1xoua_ first appeared in SCOP 1.71
  
• d1xoua_ appears in SCOPe 2.07