![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.231: EspA/CesA-like [116926] (1 superfamily) 4 helices; bundle, closed, left ight-handed twist; interlocked (hetero)dimer of 2-helical subunits |
![]() | Superfamily a.231.1: EspA/CesA-like [116927] (2 families) ![]() secreted protein and its chaperone both adopt similar substructures in the heterodimer |
![]() | Family a.231.1.1: EspA-like [116928] (1 protein) Pfam PF03433 |
![]() | Protein Secreted protein EspA [116929] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [116930] (1 PDB entry) Uniprot Q47184 31-190 |
![]() | Domain d1xoua_: 1xou A: [115715] Other proteins in same PDB: d1xoub_ |
PDB Entry: 1xou (more details), 2.8 Å
SCOPe Domain Sequences for d1xoua_:
Sequence, based on SEQRES records: (download)
>d1xoua_ a.231.1.1 (A:) Secreted protein EspA {Escherichia coli [TaxId: 562]} dvidlfnklgvfqaailmfaymyqaqsdlsiakfadmneaskesttaqkmanlvdakiad vqsssdknakaqlpdevisyindprnditisgidninaqlgagdlqtvkaaisakannlt ttvnnsqleiqqmsntlnlltsarsdmqslqyrtisgisl
>d1xoua_ a.231.1.1 (A:) Secreted protein EspA {Escherichia coli [TaxId: 562]} dvidlfnklgvfqaailmfaymyqaqsdlnltttvnnsqleiqqmsntlnlltsarsdmq slqyrtisgisl
Timeline for d1xoua_: