PDB entry 1xou

View 1xou on RCSB PDB site
Description: Crystal structure of the CesA-EspA complex
Class: Structural protein/chaperone
Keywords: coiled coil, helix bundle, heterodimer, Structural protein/chaperone COMPLEX
Deposited on 2004-10-06, released 2004-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.236
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: EspA
    Species: Escherichia coli [TaxId:562]
    Gene: espA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47184
      • modified residue (47)
      • modified residue (51)
      • modified residue (162)
      • modified residue (176)
    Domains in SCOPe 2.07: d1xoua_
  • Chain 'B':
    Compound: Z5138 gene product
    Species: Escherichia coli [TaxId:562]
    Gene: orf3
    Database cross-references and differences (RAF-indexed):
    • Uniprot O52124
      • engineered (1)
    Domains in SCOPe 2.07: d1xoub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xouA (A:)
    mdtsttasvasanaststsmaydlgsmskddvidlfnklgvfqaailmfaymyqaqsdls
    iakfadmneaskesttaqkmanlvdakiadvqsssdknakaqlpdevisyindprnditi
    sgidninaqlgagdlqtvkaaisakannltttvnnsqleiqqmsntlnlltsarsdmqsl
    qyrtisgislgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xouA (A:)
    dvidlfnklgvfqaailmfaymyqaqsdlnltttvnnsqleiqqmsntlnlltsarsdmq
    slqyrtisgisl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xouB (B:)
    mgivsqtrnkelldkkirseieaikkiiaefdvvkesvnelsekaktdpqaaeklnklie
    gytygeerklydsalskieklietlsparsksqst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xouB (B:)
    givsqtrnkelldkkirseieaikkiiaefdvvkesvnelsekaktdpqaaeklnklieg
    ytygeerklydsalskieklietl