Lineage for d1xonb_ (1xon B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [89152] (82 PDB entries)
    Uniprot Q08499 388-713
  8. Domain d1xonb_: 1xon B: [115707]
    complexed with b3p, edo, mg, pil, zn

Details for d1xonb_

PDB Entry: 1xon (more details), 1.72 Å

PDB Description: Catalytic Domain Of Human Phosphodiesterase 4D In Complex With Piclamilast
PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d1xonb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xonb_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstip

SCOPe Domain Coordinates for d1xonb_ are not available.

Timeline for d1xonb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xona_