SCOP 1.71: Domain d1xnfb_: 1xnf B:

Lineage for d1xnfb_ (1xnf B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (2 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (13 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Lipoprotein NlpI [117009] (1 species)

7. Species Escherichia coli [TaxId:562] [117010] (1 PDB entry)

8. Domain d1xnfb_: 1xnf B: [115581]
   Structural genomics target
   complexed with tmn

Details for d1xnfb_

PDB Entry: 1xnf, 1.98 Å

PDB Description: Crystal structure of E.coli TPR-protein NlpI

SCOP Domain Sequences for d1xnfb_:

Sequence; same for both SEQRES and ATOM records:

>d1xnfb_ a.118.8.1 (B:) Lipoprotein NlpI {Escherichia coli}
swrksevlavplqptlqqevilarmeqilasraltdderaqllyergvlydslglralar
ndfsqalairpdmpevfnylgiyltqagnfdaayeafdsvleldptynyahlnrgialyy
ggrdklaqddllafyqddpndpfrslwlylaeqkldekqakevlkqhfeksdkeqwgwni
vefylgniseqtlmerlkadatdntslaehlsetnfylgkyylslgdldsatalfklava
nnvhnfvehryallelsllgqd

Timeline for d1xnfb_:

• d1xnfb_ is new in SCOP 1.71
  
• d1xnfb_ appears in SCOP 1.73
  
• d1xnfb_ appears in the current release, SCOPe 2.08