Lineage for d1xnfa_ (1xnf A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542684Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 543061Superfamily a.118.8: TPR-like [48452] (2 families) (S)
  5. 543062Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (13 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 543088Protein Lipoprotein NlpI [117009] (1 species)
  7. 543089Species Escherichia coli [TaxId:562] [117010] (1 PDB entry)
  8. 543090Domain d1xnfa_: 1xnf A: [115580]

Details for d1xnfa_

PDB Entry: 1xnf (more details), 1.98 Å

PDB Description: Crystal structure of E.coli TPR-protein NlpI

SCOP Domain Sequences for d1xnfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli}
ksevlavplqptlqqevilarmeqilasraltdderaqllyergvlydslglralarndf
sqalairpdmpevfnylgiyltqagnfdaayeafdsvleldptynyahlnrgialyyggr
dklaqddllafyqddpndpfrslwlylaeqkldekqakevlkqhfeksdkeqwgwnivef
ylgniseqtlmerlkadatdntslaehlsetnfylgkyylslgdldsatalfklavannv
hnfvehryallelsllgqd

SCOP Domain Coordinates for d1xnfa_:

Click to download the PDB-style file with coordinates for d1xnfa_.
(The format of our PDB-style files is described here.)

Timeline for d1xnfa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xnfb_