Lineage for d1xnfb_ (1xnf B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007337Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (20 protein domains)
  6. 2007368Protein Lipoprotein NlpI [117009] (1 species)
  7. 2007369Species Escherichia coli [TaxId:562] [117010] (1 PDB entry)
    Uniprot P39833 26-294
  8. 2007371Domain d1xnfb_: 1xnf B: [115581]
    Structural genomics target
    complexed with trs

Details for d1xnfb_

PDB Entry: 1xnf (more details), 1.98 Å

PDB Description: Crystal structure of E.coli TPR-protein NlpI
PDB Compounds: (B:) Lipoprotein nlpI

SCOPe Domain Sequences for d1xnfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnfb_ a.118.8.1 (B:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}
swrksevlavplqptlqqevilarmeqilasraltdderaqllyergvlydslglralar
ndfsqalairpdmpevfnylgiyltqagnfdaayeafdsvleldptynyahlnrgialyy
ggrdklaqddllafyqddpndpfrslwlylaeqkldekqakevlkqhfeksdkeqwgwni
vefylgniseqtlmerlkadatdntslaehlsetnfylgkyylslgdldsatalfklava
nnvhnfvehryallelsllgqd

SCOPe Domain Coordinates for d1xnfb_:

Click to download the PDB-style file with coordinates for d1xnfb_.
(The format of our PDB-style files is described here.)

Timeline for d1xnfb_: