![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (39 proteins) |
![]() | Protein CD3 epsilon chain ectodomain fragment [69162] (3 species) possibly an intermediate structure between the I set and FnIII domains |
![]() | Species Sheep (Ovis aries) [TaxId:9940] [117040] (1 PDB entry) Uniprot P18438 22-88 |
![]() | Domain d1xmwa2: 1xmw A:113-178 [115567] MQ P22646 P18438 # artificial chimera |
PDB Entry: 1xmw (more details)
SCOPe Domain Sequences for d1xmwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmwa2 b.1.1.4 (A:113-178) CD3 epsilon chain ectodomain fragment {Sheep (Ovis aries) [TaxId: 9940]} alevleaedkvilkcnssitllqgtagqevsdnktlnlgkriedprgmyqcgenaksftl qvyyrm
Timeline for d1xmwa2: