SCOPe 2.08: Domain d1xmwa2: 1xmw A:113-178

Lineage for d1xmwa2 (1xmw A:113-178)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein CD3 epsilon chain ectodomain fragment [69162] (3 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Sheep (Ovis aries) [TaxId:9940] [117040] (1 PDB entry)
   Uniprot P18438 22-88

8. Domain d1xmwa2: 1xmw A:113-178 [115567]
   MQ P22646 P18438 # artificial chimera

Details for d1xmwa2

PDB Entry: 1xmw

PDB Description: cd3 epsilon and delta ectodomain fragment complex in single-chain construct

PDB Compounds: (A:) Chimeric CD3 mouse Epsilon and sheep Delta Ectodomain Fragment Complex

SCOPe Domain Sequences for d1xmwa2:

Sequence; same for both SEQRES and ATOM records:

>d1xmwa2 b.1.1.4 (A:113-178) CD3 epsilon chain ectodomain fragment {Sheep (Ovis aries) [TaxId: 9940]}
alevleaedkvilkcnssitllqgtagqevsdnktlnlgkriedprgmyqcgenaksftl
qvyyrm

Timeline for d1xmwa2:

• d1xmwa2 first appeared in SCOP 1.71
  
• d1xmwa2 appears in SCOPe 2.07