Lineage for d1xmwa1 (1xmw A:1-79)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026186Family b.1.1.4: I set domains [49159] (39 protein domains)
  6. 2026210Protein CD3 epsilon chain ectodomain fragment [69162] (3 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2026215Species Mouse (Mus musculus) [TaxId:10090] [69163] (2 PDB entries)
    Uniprot P22646 22-100
  8. 2026217Domain d1xmwa1: 1xmw A:1-79 [115566]
    MQ P22646 P18438 # artificial chimera

Details for d1xmwa1

PDB Entry: 1xmw (more details)

PDB Description: cd3 epsilon and delta ectodomain fragment complex in single-chain construct
PDB Compounds: (A:) Chimeric CD3 mouse Epsilon and sheep Delta Ectodomain Fragment Complex

SCOPe Domain Sequences for d1xmwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmwa1 b.1.1.4 (A:1-79) CD3 epsilon chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]}
ddaenieykvsisgtsveltcpldsdenlkwekngqelpqkhdkhlvlqdfsevedsgyy
vcytpasnkntylylkarv

SCOPe Domain Coordinates for d1xmwa1:

Click to download the PDB-style file with coordinates for d1xmwa1.
(The format of our PDB-style files is described here.)

Timeline for d1xmwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xmwa2