Lineage for d1xmcb1 (1xmc B:11-392)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1167388Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 1167389Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families) (S)
  5. 1167466Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins)
    Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains
  6. 1167514Protein Peroxisomal carnitine O-octanoyltransferase, COT [117575] (1 species)
  7. 1167515Species Mouse (Mus musculus) [TaxId:10090] [117576] (4 PDB entries)
    Uniprot Q9DC50 11-612
  8. 1167522Domain d1xmcb1: 1xmc B:11-392 [115483]
    complexed with epe, mpd; mutant

Details for d1xmcb1

PDB Entry: 1xmc (more details), 2 Å

PDB Description: c323m mutant structure of mouse carnitine octanoyltransferase
PDB Compounds: (B:) Peroxisomal carnitine O-octanoyltransferase

SCOPe Domain Sequences for d1xmcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmcb1 c.43.1.3 (B:11-392) Peroxisomal carnitine O-octanoyltransferase, COT {Mouse (Mus musculus) [TaxId: 10090]}
ertfqyqdslpslpvpaleeslkkylesvkpfanedeykkteeivqkfqegagkrlhqkl
lerargkrnwleewwlnvayldvripsqlnvnfvgpcphfehywparegtqlergsmmlw
hnlnywqllrreklpvhksgntpldmnqfrmlfstckvpgitrdsimnyfkteseghcpt
hiavlcrgrafvfdvlhegclitppellrqltyihkkcsnepvgpsiaaltseertrwak
areylisldpenltllekiqtslfvysiedssphatpeeysqvfemllggdpsvrwgdks
ynlisfangifgmccdhapydamvmvniahyvdervletegrwkgsekvrdiplpeelvf
tvdekilndvsqakaqhlkaas

SCOPe Domain Coordinates for d1xmcb1:

Click to download the PDB-style file with coordinates for d1xmcb1.
(The format of our PDB-style files is described here.)

Timeline for d1xmcb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xmcb2