Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families) |
Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins) Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains |
Protein Peroxisomal carnitine O-octanoyltransferase, COT [117575] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [117576] (4 PDB entries) Uniprot Q9DC50 11-612 |
Domain d1xmcb1: 1xmc B:11-392 [115483] complexed with epe, mpd; mutant |
PDB Entry: 1xmc (more details), 2 Å
SCOPe Domain Sequences for d1xmcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmcb1 c.43.1.3 (B:11-392) Peroxisomal carnitine O-octanoyltransferase, COT {Mouse (Mus musculus) [TaxId: 10090]} ertfqyqdslpslpvpaleeslkkylesvkpfanedeykkteeivqkfqegagkrlhqkl lerargkrnwleewwlnvayldvripsqlnvnfvgpcphfehywparegtqlergsmmlw hnlnywqllrreklpvhksgntpldmnqfrmlfstckvpgitrdsimnyfkteseghcpt hiavlcrgrafvfdvlhegclitppellrqltyihkkcsnepvgpsiaaltseertrwak areylisldpenltllekiqtslfvysiedssphatpeeysqvfemllggdpsvrwgdks ynlisfangifgmccdhapydamvmvniahyvdervletegrwkgsekvrdiplpeelvf tvdekilndvsqakaqhlkaas
Timeline for d1xmcb1: