SCOPe 2.01: Domain d1xm8b_: 1xm8 B:

Lineage for d1xm8b_ (1xm8 B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.2: Glyoxalase II (hydroxyacylglutathione hydrolase) [56288] (1 protein)

6. Protein Glyoxalase II (hydroxyacylglutathione hydrolase) [56289] (3 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118145] (2 PDB entries)
   Uniprot Q9SID3

8. Domain d1xm8b_: 1xm8 B: [115476]
   Structural genomics target
   complexed with acy, fe, peg, zn

Details for d1xm8b_

PDB Entry: 1xm8, 1.74 Å

PDB Description: x-ray structure of glyoxalase ii from arabidopsis thaliana gene at2g31350

PDB Compounds: (B:) glyoxalase II

SCOPe Domain Sequences for d1xm8b_:

Sequence; same for both SEQRES and ATOM records:

>d1xm8b_ d.157.1.2 (B:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mqielvpclkdnyayilhdedtgtvgvvdpseaepiidslkrsgrnltyilnthhhydht
ggnlelkdrygakvigsamdkdripgidmalkdgdkwmfaghevhvmdtpghtkghisly
fpgsraiftgdtmfslscgklfegtpkqmlaslqkitslpddtsiycgheytlsnskfal
slepnnevlqsyaahvaelrskklptipttvkmekacnpflrssntdirralripeaade
aealgiirkakddf

Timeline for d1xm8b_:

• d1xm8b_ first appeared in SCOP 1.71
  
• d1xm8b_ appears in SCOP 1.75
  
• d1xm8b_ appears in SCOPe 2.02
  
• d1xm8b_ appears in the current release, SCOPe 2.08, called d1xm8b1