Lineage for d1xm8b1 (1xm8 B:2-254)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997085Family d.157.1.2: Glyoxalase II (hydroxyacylglutathione hydrolase) [56288] (1 protein)
  6. 2997086Protein Glyoxalase II (hydroxyacylglutathione hydrolase) [56289] (3 species)
  7. 2997094Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118145] (2 PDB entries)
    Uniprot Q9SID3
  8. 2997098Domain d1xm8b1: 1xm8 B:2-254 [115476]
    Other proteins in same PDB: d1xm8a2, d1xm8b2
    Structural genomics target
    complexed with acy, fe, peg, zn

Details for d1xm8b1

PDB Entry: 1xm8 (more details), 1.74 Å

PDB Description: x-ray structure of glyoxalase ii from arabidopsis thaliana gene at2g31350
PDB Compounds: (B:) glyoxalase II

SCOPe Domain Sequences for d1xm8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xm8b1 d.157.1.2 (B:2-254) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qielvpclkdnyayilhdedtgtvgvvdpseaepiidslkrsgrnltyilnthhhydhtg
gnlelkdrygakvigsamdkdripgidmalkdgdkwmfaghevhvmdtpghtkghislyf
pgsraiftgdtmfslscgklfegtpkqmlaslqkitslpddtsiycgheytlsnskfals
lepnnevlqsyaahvaelrskklptipttvkmekacnpflrssntdirralripeaadea
ealgiirkakddf

SCOPe Domain Coordinates for d1xm8b1:

Click to download the PDB-style file with coordinates for d1xm8b1.
(The format of our PDB-style files is described here.)

Timeline for d1xm8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xm8b2