Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.15: Predicted metal-dependent hydrolase [103132] (4 proteins) Pfam PF02130; UPF0054; COG0319; MMP-like fold with a different sequence motif in the putative active site |
Protein Hypothetical protein YbeY [118048] (1 species) |
Species Escherichia coli [TaxId:562] [118049] (1 PDB entry) Uniprot P77385 |
Domain d1xm5b_: 1xm5 B: [115468] Structural genomics target complexed with ni |
PDB Entry: 1xm5 (more details), 2.7 Å
SCOPe Domain Sequences for d1xm5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xm5b_ d.92.1.15 (B:) Hypothetical protein YbeY {Escherichia coli [TaxId: 562]} msqvildlqlacednsglpeesqfqtwlnavipqfqeesevtirvvdtaeshslnltyrg kdkptnvlsfpfevppgmemsllgdlvicrqvvekeaqeqgkpleahwahmvvhgslhll gydhieddeaeemealeteimlalgyedpyia
Timeline for d1xm5b_: