Lineage for d1xm5d_ (1xm5 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964844Family d.92.1.15: Predicted metal-dependent hydrolase [103132] (4 proteins)
    Pfam PF02130; UPF0054; COG0319; MMP-like fold with a different sequence motif in the putative active site
  6. 2964851Protein Hypothetical protein YbeY [118048] (1 species)
  7. 2964852Species Escherichia coli [TaxId:562] [118049] (1 PDB entry)
    Uniprot P77385
  8. 2964856Domain d1xm5d_: 1xm5 D: [115470]
    Structural genomics target
    complexed with ni

Details for d1xm5d_

PDB Entry: 1xm5 (more details), 2.7 Å

PDB Description: crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054
PDB Compounds: (D:) Hypothetical UPF0054 protein ybeY

SCOPe Domain Sequences for d1xm5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xm5d_ d.92.1.15 (D:) Hypothetical protein YbeY {Escherichia coli [TaxId: 562]}
msqvildlqlacednsglpeesqfqtwlnavipqfqeesevtirvvdtaeshslnltyrg
kdkptnvlsfpfevppgmemsllgdlvicrqvvekeaqeqgkpleahwahmvvhgslhll
gydhieddeaeemealeteimlalgyedpyia

SCOPe Domain Coordinates for d1xm5d_:

Click to download the PDB-style file with coordinates for d1xm5d_.
(The format of our PDB-style files is described here.)

Timeline for d1xm5d_: