![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.15: Predicted metal-dependent hydrolase [103132] (4 proteins) Pfam PF02130; UPF0054; COG0319; MMP-like fold with a different sequence motif in the putative active site |
![]() | Protein Hypothetical protein YbeY [118048] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [118049] (1 PDB entry) Uniprot P77385 |
![]() | Domain d1xm5d_: 1xm5 D: [115470] Structural genomics target complexed with ni |
PDB Entry: 1xm5 (more details), 2.7 Å
SCOPe Domain Sequences for d1xm5d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xm5d_ d.92.1.15 (D:) Hypothetical protein YbeY {Escherichia coli [TaxId: 562]} msqvildlqlacednsglpeesqfqtwlnavipqfqeesevtirvvdtaeshslnltyrg kdkptnvlsfpfevppgmemsllgdlvicrqvvekeaqeqgkpleahwahmvvhgslhll gydhieddeaeemealeteimlalgyedpyia
Timeline for d1xm5d_: