SCOP 1.71: Domain d1xl6b2: 1xl6 B:23-138

Lineage for d1xl6b2 (1xl6 B:23-138)

1. Root: SCOP 1.71

2. Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins)

6. Protein Inward rectifier potassium channel kirbac3.1 [118227] (1 species)

7. Species Magnetospirillum magnetotacticum [TaxId:188] [118228] (2 PDB entries)

8. Domain d1xl6b2: 1xl6 B:23-138 [115437]
   Other proteins in same PDB: d1xl6a1, d1xl6b1
   complexed with k, mg, spm

Details for d1xl6b2

PDB Entry: 1xl6, 2.85 Å

PDB Description: Intermediate gating structure 2 of the inwardly rectifying K+ channel KirBac3.1

SCOP Domain Sequences for d1xl6b2:

Sequence; same for both SEQRES and ATOM records:

>d1xl6b2 f.14.1.1 (B:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum}
itrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylacgdvienarpgs
ftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasliyarftrp

Timeline for d1xl6b2:

• d1xl6b2 is new in SCOP 1.71
  
• d1xl6b2 appears in SCOP 1.73
  
• d1xl6b2 appears in the current release, SCOPe 2.08