SCOP 1.71: Domain d1xl6a1: 1xl6 A:139-299

Lineage for d1xl6a1 (1xl6 A:139-299)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (3 proteins)

6. Protein Inward rectifier potassium channel kirbac3.1 [117047] (1 species)

7. Species Magnetospirillum magnetotacticum [TaxId:188] [117048] (2 PDB entries)

8. Domain d1xl6a1: 1xl6 A:139-299 [115434]
   Other proteins in same PDB: d1xl6a2, d1xl6b2

Details for d1xl6a1

PDB Entry: 1xl6, 2.85 Å

PDB Description: Intermediate gating structure 2 of the inwardly rectifying K+ channel KirBac3.1

SCOP Domain Sequences for d1xl6a1:

Sequence; same for both SEQRES and ATOM records:

>d1xl6a1 b.1.18.16 (A:139-299) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum}
tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl
tltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh
ayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhh

Timeline for d1xl6a1:

• d1xl6a1 is new in SCOP 1.71
  
• d1xl6a1 appears in SCOP 1.73
  
• d1xl6a1 appears in the current release, SCOPe 2.08