SCOPe 2.08: Domain d1xl6b2: 1xl6 B:23-138

Lineage for d1xl6b2 (1xl6 B:23-138)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families)
   Pfam PF00520

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Inward rectifier potassium channel kirbac3.1 [118227] (1 species)

7. Species Magnetospirillum magnetotacticum [TaxId:188] [118228] (4 PDB entries)
   Uniprot Q8YY97 # 46% sequence identity; Anabaena sp. PCC 7120 TaxID: 103690

8. Domain d1xl6b2: 1xl6 B:23-138 [115437]
   Other proteins in same PDB: d1xl6a1, d1xl6a3, d1xl6b1, d1xl6b3
   complexed with k, mg, spm

Details for d1xl6b2

PDB Entry: 1xl6, 2.85 Å

PDB Description: Intermediate gating structure 2 of the inwardly rectifying K+ channel KirBac3.1

PDB Compounds: (B:) Inward rectifier potassium channel

SCOPe Domain Sequences for d1xl6b2:

Sequence; same for both SEQRES and ATOM records:

>d1xl6b2 f.14.1.1 (B:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]}
itrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylacgdvienarpgs
ftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasliyarftrp

Timeline for d1xl6b2:

• d1xl6b2 first appeared in SCOP 1.71
  
• d1xl6b2 appears in SCOPe 2.07