Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.3: Phage lysozyme [53981] (4 proteins) |
Protein Endolysin Lyz [117758] (1 species) |
Species Bacteriophage P1 [TaxId:10678] [117759] (2 PDB entries) Uniprot Q37875 1-185 |
Domain d1xjub1: 1xju B:29-185 [115395] Other proteins in same PDB: d1xjua2, d1xjub2 structure of secreted inactive form complexed with so4 |
PDB Entry: 1xju (more details), 1.07 Å
SCOPe Domain Sequences for d1xjub1:
Sequence, based on SEQRES records: (download)
>d1xjub1 d.2.1.3 (B:29-185) Endolysin Lyz {Bacteriophage P1 [TaxId: 10678]} rtnqaglelignaegcrrdpymcpagvwtdgignthgvtpgvrktdqqiaadweknilia ercinqhfrgkdmpdnafsamtsaafnmgcnslrtyyskargmrvetsihkwaqkgewvn mcnhlpdfvnsngvplrglkirrekerqlcltglvne
>d1xjub1 d.2.1.3 (B:29-185) Endolysin Lyz {Bacteriophage P1 [TaxId: 10678]} rtnqaglelignaegcrrdpymcpagvwtdgiggvtpgvrktdqqiaadwekniliaerc inqhfrgkdmpdnafsamtsaafnmgcnslrtyyskargmrvetsihkwaqkgewvnmcn hlpdfvnsngvplrglkirrekerqlcltglvne
Timeline for d1xjub1: