SCOPe 2.08: Domain d1xjub1: 1xju B:29-185

Lineage for d1xjub1 (1xju B:29-185)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Endolysin Lyz [117758] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [117759] (2 PDB entries)
   Uniprot Q37875 1-185

8. Domain d1xjub1: 1xju B:29-185 [115395]
   Other proteins in same PDB: d1xjua2, d1xjub2
   structure of secreted inactive form
   complexed with so4

Details for d1xjub1

PDB Entry: 1xju, 1.07 Å

PDB Description: crystal structure of secreted inactive form of p1 phage endolysin lyz

PDB Compounds: (B:) lysozyme

SCOPe Domain Sequences for d1xjub1:

Sequence, based on SEQRES records:

>d1xjub1 d.2.1.3 (B:29-185) Endolysin Lyz {Bacteriophage P1 [TaxId: 10678]}
rtnqaglelignaegcrrdpymcpagvwtdgignthgvtpgvrktdqqiaadweknilia
ercinqhfrgkdmpdnafsamtsaafnmgcnslrtyyskargmrvetsihkwaqkgewvn
mcnhlpdfvnsngvplrglkirrekerqlcltglvne

Sequence, based on observed residues (ATOM records):

>d1xjub1 d.2.1.3 (B:29-185) Endolysin Lyz {Bacteriophage P1 [TaxId: 10678]}
rtnqaglelignaegcrrdpymcpagvwtdgiggvtpgvrktdqqiaadwekniliaerc
inqhfrgkdmpdnafsamtsaafnmgcnslrtyyskargmrvetsihkwaqkgewvnmcn
hlpdfvnsngvplrglkirrekerqlcltglvne

Timeline for d1xjub1:

• d1xjub1 first appeared in SCOP 1.71, called d1xjub_
  
• d1xjub1 appears in SCOPe 2.07