Lineage for d1xj5c_ (1xj5 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893343Family c.66.1.17: Spermidine synthase [69557] (3 proteins)
    contains additional N-terminal tetramerisation all-beta domain, res. 1-71
  6. 2893348Protein Spermidine synthase [69558] (6 species)
    polyamine aminopropyltransferase
  7. 2893367Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117680] (4 PDB entries)
    Uniprot Q9ZUB3
  8. 2893386Domain d1xj5c_: 1xj5 C: [115380]

Details for d1xj5c_

PDB Entry: 1xj5 (more details), 2.7 Å

PDB Description: x-ray structure of spermidine synthase from arabidopsis thaliana gene at1g23820
PDB Compounds: (C:) Spermidine synthase 1

SCOPe Domain Sequences for d1xj5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xj5c_ c.66.1.17 (C:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
stvipgwfsemspmwpgeahslkvekvlfqgksdyqdvivfqsatygkvlvldgviqlte
rdecayqemithlplcsipnpkkvlvigggdggvlrevarhasieqidmceidkmvvdvs
kqffpdvaigyedprvnlvigdgvaflknaaegsydavivdssdpigpakelfekpffqs
varalrpggvvctqaeslwlhmdiiedivsncreifkgsvnyawtsvptypsgvigfmlc
stegpdvdfkhplnpidesssksngplkfynaeihsaafclpsfakkvie

SCOPe Domain Coordinates for d1xj5c_:

Click to download the PDB-style file with coordinates for d1xj5c_.
(The format of our PDB-style files is described here.)

Timeline for d1xj5c_: