PDB entry 1xj5

View 1xj5 on RCSB PDB site
Description: x-ray structure of spermidine synthase from arabidopsis thaliana gene at1g23820
Class: transferase
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, CESG, AT1G23820, PUTRESCINE AMINOPROPYL TRANSFERASE, SPERMIDINE SYNTHASE, SPDS1, POLYAMINE, Center for Eukaryotic Structural Genomics, TRANSFERASE
Deposited on 2004-09-22, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spermidine synthase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT1G23820
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZUB3
      • modified residue (50)
      • modified residue (53)
      • modified residue (108)
      • modified residue (148)
      • modified residue (154)
      • modified residue (241)
      • modified residue (277)
    Domains in SCOPe 2.07: d1xj5a_
  • Chain 'B':
    Compound: Spermidine synthase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT1G23820
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZUB3
      • modified residue (50)
      • modified residue (53)
      • modified residue (108)
      • modified residue (148)
      • modified residue (154)
      • modified residue (241)
      • modified residue (277)
    Domains in SCOPe 2.07: d1xj5b_
  • Chain 'C':
    Compound: Spermidine synthase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT1G23820
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZUB3
      • modified residue (50)
      • modified residue (53)
      • modified residue (108)
      • modified residue (148)
      • modified residue (154)
      • modified residue (241)
      • modified residue (277)
    Domains in SCOPe 2.07: d1xj5c_
  • Chain 'D':
    Compound: Spermidine synthase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT1G23820
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZUB3
      • modified residue (50)
      • modified residue (53)
      • modified residue (108)
      • modified residue (148)
      • modified residue (154)
      • modified residue (241)
      • modified residue (277)
    Domains in SCOPe 2.07: d1xj5d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xj5A (A:)
    sdaketsatdlkrpreeddnggaatmetengdqkkepacfstvipgwfsemspmwpgeah
    slkvekvlfqgksdyqdvivfqsatygkvlvldgviqlterdecayqemithlplcsipn
    pkkvlvigggdggvlrevarhasieqidmceidkmvvdvskqffpdvaigyedprvnlvi
    gdgvaflknaaegsydavivdssdpigpakelfekpffqsvaralrpggvvctqaeslwl
    hmdiiedivsncreifkgsvnyawtsvptypsgvigfmlcstegpdvdfkhplnpidess
    sksngplkfynaeihsaafclpsfakkvieskan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xj5A (A:)
    stvipgwfsemspmwpgeahslkvekvlfqgksdyqdvivfqsatygkvlvldgviqlte
    rdecayqemithlplcsipnpkkvlvigggdggvlrevarhasieqidmceidkmvvdvs
    kqffpdvaigyedprvnlvigdgvaflknaaegsydavivdssdpigpakelfekpffqs
    varalrpggvvctqaeslwlhmdiiedivsncreifkgsvnyawtsvptypsgvigfmlc
    stegpdvdfkhplnpidesssksngplkfynaeihsaafclpsfakkvie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xj5B (B:)
    sdaketsatdlkrpreeddnggaatmetengdqkkepacfstvipgwfsemspmwpgeah
    slkvekvlfqgksdyqdvivfqsatygkvlvldgviqlterdecayqemithlplcsipn
    pkkvlvigggdggvlrevarhasieqidmceidkmvvdvskqffpdvaigyedprvnlvi
    gdgvaflknaaegsydavivdssdpigpakelfekpffqsvaralrpggvvctqaeslwl
    hmdiiedivsncreifkgsvnyawtsvptypsgvigfmlcstegpdvdfkhplnpidess
    sksngplkfynaeihsaafclpsfakkvieskan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xj5B (B:)
    acfstvipgwfsemspmwpgeahslkvekvlfqgksdyqdvivfqsatygkvlvldgviq
    lterdecayqemithlplcsipnpkkvlvigggdggvlrevarhasieqidmceidkmvv
    dvskqffpdvaigyedprvnlvigdgvaflknaaegsydavivdssdpigpakelfekpf
    fqsvaralrpggvvctqaeslwlhmdiiedivsncreifkgsvnyawtsvptypsgvigf
    mlcstegpdvdfkhplnpigplkfynaeihsaafclpsfakkvie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xj5C (C:)
    sdaketsatdlkrpreeddnggaatmetengdqkkepacfstvipgwfsemspmwpgeah
    slkvekvlfqgksdyqdvivfqsatygkvlvldgviqlterdecayqemithlplcsipn
    pkkvlvigggdggvlrevarhasieqidmceidkmvvdvskqffpdvaigyedprvnlvi
    gdgvaflknaaegsydavivdssdpigpakelfekpffqsvaralrpggvvctqaeslwl
    hmdiiedivsncreifkgsvnyawtsvptypsgvigfmlcstegpdvdfkhplnpidess
    sksngplkfynaeihsaafclpsfakkvieskan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xj5C (C:)
    stvipgwfsemspmwpgeahslkvekvlfqgksdyqdvivfqsatygkvlvldgviqlte
    rdecayqemithlplcsipnpkkvlvigggdggvlrevarhasieqidmceidkmvvdvs
    kqffpdvaigyedprvnlvigdgvaflknaaegsydavivdssdpigpakelfekpffqs
    varalrpggvvctqaeslwlhmdiiedivsncreifkgsvnyawtsvptypsgvigfmlc
    stegpdvdfkhplnpidesssksngplkfynaeihsaafclpsfakkvie
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xj5D (D:)
    sdaketsatdlkrpreeddnggaatmetengdqkkepacfstvipgwfsemspmwpgeah
    slkvekvlfqgksdyqdvivfqsatygkvlvldgviqlterdecayqemithlplcsipn
    pkkvlvigggdggvlrevarhasieqidmceidkmvvdvskqffpdvaigyedprvnlvi
    gdgvaflknaaegsydavivdssdpigpakelfekpffqsvaralrpggvvctqaeslwl
    hmdiiedivsncreifkgsvnyawtsvptypsgvigfmlcstegpdvdfkhplnpidess
    sksngplkfynaeihsaafclpsfakkvieskan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xj5D (D:)
    acfstvipgwfsemspmwpgeahslkvekvlfqgksdyqdvivfqsatygkvlvldgviq
    lterdecayqemithlplcsipnpkkvlvigggdggvlrevarhasieqidmceidkmvv
    dvskqffpdvaigyedprvnlvigdgvaflknaaegsydavivdssdpigpakelfekpf
    fqsvaralrpggvvctqaeslwlhmdiiedivsncreifkgsvnyawtsvptypsgvigf
    mlcstegpdvdfkhplnpigplkfynaeihsaafclpsfakkvie