Lineage for d1xhkb1 (1xhk B:456-640)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157367Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2157368Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2158021Family d.14.1.10: ATP-dependent protease Lon (La), catalytic domain [102769] (1 protein)
    contains extra C-terminal alpha/beta subdomain
    automatically mapped to Pfam PF05362
  6. 2158022Protein ATP-dependent protease Lon (La), catalytic domain [102770] (2 species)
  7. 2158060Species Methanococcus jannaschii [TaxId:2190] [117794] (1 PDB entry)
    Uniprot Q58812 456-640 # MJ1417
  8. 2158062Domain d1xhkb1: 1xhk B:456-640 [115300]
    Other proteins in same PDB: d1xhkb2
    complexed with mes, so4

Details for d1xhkb1

PDB Entry: 1xhk (more details), 1.9 Å

PDB Description: Crystal structure of M. jannaschii Lon proteolytic domain
PDB Compounds: (B:) Putative protease La homolog

SCOPe Domain Sequences for d1xhkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhkb1 d.14.1.10 (B:456-640) ATP-dependent protease Lon (La), catalytic domain {Methanococcus jannaschii [TaxId: 2190]}
epkvgviyglavlgaggigdvtkiivqilesknpgthllnisgdiakhsitlasalskkl
vaekklplpkkdidlnnkeiyiqfsqsyskidgdsataavclaiisalldiplkqdfait
gsldlsgnvlaiggvnekieaakrygfkrviipeanmidvietegieiipvktldeivpl
vfdld

SCOPe Domain Coordinates for d1xhkb1:

Click to download the PDB-style file with coordinates for d1xhkb1.
(The format of our PDB-style files is described here.)

Timeline for d1xhkb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xhkb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1xhka_