![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.10: ATP-dependent protease Lon (La), catalytic domain [102769] (1 protein) contains extra C-terminal alpha/beta subdomain automatically mapped to Pfam PF05362 |
![]() | Protein ATP-dependent protease Lon (La), catalytic domain [102770] (2 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [117794] (1 PDB entry) Uniprot Q58812 456-640 # MJ1417 |
![]() | Domain d1xhkb1: 1xhk B:456-640 [115300] Other proteins in same PDB: d1xhkb2 complexed with mes, so4 |
PDB Entry: 1xhk (more details), 1.9 Å
SCOPe Domain Sequences for d1xhkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xhkb1 d.14.1.10 (B:456-640) ATP-dependent protease Lon (La), catalytic domain {Methanococcus jannaschii [TaxId: 2190]} epkvgviyglavlgaggigdvtkiivqilesknpgthllnisgdiakhsitlasalskkl vaekklplpkkdidlnnkeiyiqfsqsyskidgdsataavclaiisalldiplkqdfait gsldlsgnvlaiggvnekieaakrygfkrviipeanmidvietegieiipvktldeivpl vfdld
Timeline for d1xhkb1: