PDB entry 1xhk

View 1xhk on RCSB PDB site
Description: Crystal structure of M. jannaschii Lon proteolytic domain
Class: hydrolase
Keywords: Lon protease, protease La, ATP dependent, catalytic dyad, HYDROLASE
Deposited on 2004-09-20, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.226
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative protease La homolog
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ1417
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58812 (2-186)
      • modified residue (158)
    Domains in SCOPe 2.07: d1xhka_
  • Chain 'B':
    Compound: Putative protease La homolog
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ1417
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58812 (2-186)
      • cloning artifact (0-1)
      • modified residue (158)
    Domains in SCOPe 2.07: d1xhkb1, d1xhkb2
  • Heterogens: SO4, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xhkA (A:)
    hmepkvgviyglavlgaggigdvtkiivqilesknpgthllnisgdiakhsitlasalsk
    klvaekklplpkkdidlnnkeiyiqfsqsyskidgdsataavclaiisalldiplkqdfa
    itgsldlsgnvlaiggvnekieaakrygfkrviipeanmidvietegieiipvktldeiv
    plvfdld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhkA (A:)
    epkvgviyglavlgaggigdvtkiivqilesknpgthllnisgdiakhsitlasalskkl
    vaekklplpkkdidlnnkeiyiqfsqsyskidgdsataavclaiisalldiplkqdfait
    gsldlsgnvlaiggvnekieaakrygfkrviipeanmidvietegieiipvktldeivpl
    vfdld
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xhkB (B:)
    hmepkvgviyglavlgaggigdvtkiivqilesknpgthllnisgdiakhsitlasalsk
    klvaekklplpkkdidlnnkeiyiqfsqsyskidgdsataavclaiisalldiplkqdfa
    itgsldlsgnvlaiggvnekieaakrygfkrviipeanmidvietegieiipvktldeiv
    plvfdld