SCOP 1.73: Domain d1xebd_: 1xeb D:

Lineage for d1xebd_ (1xeb D:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)

6. Protein Hypothetical protein PA0115 [118066] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [118067] (1 PDB entry)

8. Domain d1xebd_: 1xeb D: [115222]

Details for d1xebd_

PDB Entry: 1xeb, 2.35 Å

PDB Description: Crystal Structure of an Acyl-CoA N-acyltransferase from Pseudomonas aeruginosa

PDB Compounds: (D:) hypothetical protein PA0115

SCOP Domain Sequences for d1xebd_:

Sequence; same for both SEQRES and ATOM records:

>d1xebd_ d.108.1.1 (D:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]}
ldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgqlla
ylrlldpvrhegqvvigrvvsssaargqglghqlmeralqaaerlwldtpvylsaqahlq
ayygrygfvavtevyleddiphigmrra

Timeline for d1xebd_:

• d1xebd_ first appeared in SCOP 1.71
  
• d1xebd_ appears in SCOP 1.75
  
• d1xebd_ appears in the current release, SCOPe 2.08