Lineage for d1xd3c_ (1xd3 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927232Family d.3.1.6: Ubiquitin carboxyl-terminal hydrolase UCH-L [54050] (3 proteins)
    automatically mapped to Pfam PF01088
  6. 2927241Protein Ubiquitin carboxyl-terminal hydrolase UCH-l3 [54051] (2 species)
  7. 2927242Species Human (Homo sapiens) [TaxId:9606] [54052] (3 PDB entries)
    Uniprot P15374
  8. 2927244Domain d1xd3c_: 1xd3 C: [115147]
    Other proteins in same PDB: d1xd3b_, d1xd3d_
    complexed with gve, mg

Details for d1xd3c_

PDB Entry: 1xd3 (more details), 1.45 Å

PDB Description: Crystal structure of UCHL3-UbVME complex
PDB Compounds: (C:) Ubiquitin Carboxyl-terminal esterase L3

SCOPe Domain Sequences for d1xd3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xd3c_ d.3.1.6 (C:) Ubiquitin carboxyl-terminal hydrolase UCH-l3 {Human (Homo sapiens) [TaxId: 9606]}
qrwlpleanpevtnqflkqlglhpnwqfvdvygmdpellsmvprpvcavlllfpitekye
vfrteeeekiksqgqdvtssvyfmkqtisnacgtiglihaiannkdkmhfesgstlkkfl
eesvsmspeerarylenydairvthetsahegqteapsidekvdlhfialvhvdghlyel
dgrkpfpinhgetsdetlledaievckkfmerdpdelrfnaialsaa

SCOPe Domain Coordinates for d1xd3c_:

Click to download the PDB-style file with coordinates for d1xd3c_.
(The format of our PDB-style files is described here.)

Timeline for d1xd3c_: