Lineage for d1xd3c_ (1xd3 C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597009Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 597010Superfamily d.3.1: Cysteine proteinases [54001] (12 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 597299Family d.3.1.6: Ubiquitin carboxyl-terminal hydrolase UCH-l3 [54050] (1 protein)
  6. 597300Protein Ubiquitin carboxyl-terminal hydrolase UCH-l3 [54051] (2 species)
  7. 597301Species Human (Homo sapiens) [TaxId:9606] [54052] (2 PDB entries)
  8. 597303Domain d1xd3c_: 1xd3 C: [115147]
    Other proteins in same PDB: d1xd3b_, d1xd3d_
    complexed with gve, mg

Details for d1xd3c_

PDB Entry: 1xd3 (more details), 1.45 Å

PDB Description: Crystal structure of UCHL3-UbVME complex

SCOP Domain Sequences for d1xd3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xd3c_ d.3.1.6 (C:) Ubiquitin carboxyl-terminal hydrolase UCH-l3 {Human (Homo sapiens)}
qrwlpleanpevtnqflkqlglhpnwqfvdvygmdpellsmvprpvcavlllfpitekye
vfrteeeekiksqgqdvtssvyfmkqtisnacgtiglihaiannkdkmhfesgstlkkfl
eesvsmspeerarylenydairvthetsahegqteapsidekvdlhfialvhvdghlyel
dgrkpfpinhgetsdetlledaievckkfmerdpdelrfnaialsaa

SCOP Domain Coordinates for d1xd3c_:

Click to download the PDB-style file with coordinates for d1xd3c_.
(The format of our PDB-style files is described here.)

Timeline for d1xd3c_: