SCOP 1.71: Domain d1xb2a1: 1xb2 A:251-348

Lineage for d1xb2a1 (1xb2 A:251-348)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (3 families)

5. Family b.43.3.1: Elongation factors [50448] (9 proteins)

6. Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
   N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology

7. Species Cow (Bos taurus), mitochondrial [TaxId:9913] [50453] (2 PDB entries)

8. Domain d1xb2a1: 1xb2 A:251-348 [115054]
   Other proteins in same PDB: d1xb2a2, d1xb2a3, d1xb2b1, d1xb2b2, d1xb2b3

Details for d1xb2a1

PDB Entry: 1xb2, 2.2 Å

PDB Description: Crystal Structure of Bos taurus mitochondrial Elongation Factor Tu/Ts Complex

SCOP Domain Sequences for d1xb2a1:

Sequence; same for both SEQRES and ATOM records:

>d1xb2a1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial}
trdlekpfllpvesvysipgrgtvvtgtlergilkkgdeceflghsknirtvvtgiemfh
ksldraeagdnlgalvrglkredlrrglvmakpgsiqp

Timeline for d1xb2a1:

• d1xb2a1 is new in SCOP 1.71
  
• d1xb2a1 appears in SCOP 1.73
  
• d1xb2a1 appears in the current release, SCOPe 2.08