Lineage for d1xb2a1 (1xb2 A:251-348)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2792985Family b.43.3.1: Elongation factors [50448] (11 proteins)
  6. 2793069Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 2793070Species Cow (Bos taurus), mitochondrial [TaxId:9913] [50453] (2 PDB entries)
    Uniprot P49410 56-452
  8. 2793071Domain d1xb2a1: 1xb2 A:251-348 [115054]
    Other proteins in same PDB: d1xb2a2, d1xb2a3, d1xb2b1, d1xb2b2, d1xb2b3

Details for d1xb2a1

PDB Entry: 1xb2 (more details), 2.2 Å

PDB Description: Crystal Structure of Bos taurus mitochondrial Elongation Factor Tu/Ts Complex
PDB Compounds: (A:) Elongation factor Tu, mitochondrial

SCOPe Domain Sequences for d1xb2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xb2a1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]}
trdlekpfllpvesvysipgrgtvvtgtlergilkkgdeceflghsknirtvvtgiemfh
ksldraeagdnlgalvrglkredlrrglvmakpgsiqp

SCOPe Domain Coordinates for d1xb2a1:

Click to download the PDB-style file with coordinates for d1xb2a1.
(The format of our PDB-style files is described here.)

Timeline for d1xb2a1: