PDB entry 1xb2

View 1xb2 on RCSB PDB site
Description:
Deposited on 2004-08-27, released 2004-11-23
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-23, with a file datestamp of 2004-11-23.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xb2A (A:)
    aveakktyvrdkphvnvgtighvdhgkttltaaitkilaegggakfkkyeeidnapeera
    rgitinaahveystaarhyahtdcpghadyvknmitgtapldgcilvvaandgpmpqtre
    hlllarqigvehvvvyvnkadavqdsemvelveleirelltefgykgeetpiivgsalca
    leqrdpelglksvqklldavdtyipvptrdlekpfllpvesvysipgrgtvvtgtlergi
    lkkgdeceflghsknirtvvtgiemfhksldraeagdnlgalvrglkredlrrglvmakp
    gsiqphqkveaqvyiltkeeggrhkpfvshfmpvmfsltwdmacriilppgkelampged
    lkltlilrqpmilekgqrftlrdgnrtigtglvtdtpamteedknikws
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb2A (A:)
    phvnvgtighvdhgkttltaaitkilaehveystaarhyahtdcpghadyvknmitgtap
    ldgcilvvaandgpmpqtrehlllarqigvehvvvyvnkadavqdsemvelveleirell
    tefgykgeetpiivgsalcaleqrdpelglksvqklldavdtyipvptrdlekpfllpve
    svysipgrgtvvtgtlergilkkgdeceflghsknirtvvtgiemfhksldraeagdnlg
    alvrglkredlrrglvmakpgsiqphqkveaqvyiltkeeggrhkpfvshfmpvmfsltw
    dmacriilppgkelampgedlkltlilrqpmilekgqrftlrdgnrtigtglvtdtpamt
    eedknikws
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xb2B (B:)
    sasskellmklrrktgysfinckkaletcggdlkqaeswlhkqaqkegwskaarlhgrkt
    kegligllqegdttvlvevncetdfvsrnlkfqqlvqqvalgtllhcqnlkdqlstyskg
    flnsselselpagperegslkdqlalaigklgenmilkraawvkvpagfyvgsyvhgamh
    spslhnlvlgkygalvicetselkanladlgrrlgqhvvgmaplsvgslddepggeaetk
    mlsqpylldpsitlgqyvqphgvsvvdfvrfecgegedaadaelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb2B (B:)
    sasskellmklrrktgysfinckkaletcggdlkqaeswlhkqaqkegwskaarlhgrkt
    kegligllqegdttvlvevncetdfvsrnlkfqqlvqqvalgtllhcqnlkdqlstyskg
    flnsselselpagperegslkdqlalaigklgenmilkraawvkvpagfyvgsyvhgamh
    spslhnlvlgkygalvicetselkanladlgrrlgqhvvgmaplsvgslddepggeaetk
    mlsqpylldpsitlgqyvqphgvsvvdfvrfecgeg