Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein Staphopain SspB [102721] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [102722] (3 PDB entries) Uniprot Q70UQ9 41-393 |
Domain d1x9yc1: 1x9y C:223-393 [115015] Other proteins in same PDB: d1x9ya2, d1x9yb2, d1x9yc2, d1x9yd2 |
PDB Entry: 1x9y (more details), 2.5 Å
SCOPe Domain Sequences for d1x9yc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x9yc1 d.3.1.1 (C:223-393) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]} qyentlknfkireqqfdnswcagfsmaallnatkntdtynahdimrtlypevseqdlpnc atfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvsqnpndphlghal avvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsmigy
Timeline for d1x9yc1: