SCOPe 2.04: Domain d1x9sb_: 1x9s B:

Lineage for d1x9sb_ (1x9s B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (15 species)

7. Species Escherichia coli [TaxId:562] [52836] (47 PDB entries)
   Uniprot P00274 ! Uniprot P00581

8. Domain d1x9sb_: 1x9s B: [115007]
   Other proteins in same PDB: d1x9sa1, d1x9sa2
   protein/DNA complex; complexed with mg

Details for d1x9sb_

PDB Entry: 1x9s, 2.7 Å

PDB Description: T7 DNA polymerase in complex with a primer/template DNA containing a disordered N-2 aminofluorene on the template, crystallized with dideoxy-CTP as the incoming nucleotide.

PDB Compounds: (B:) Thioredoxin 1

SCOPe Domain Sequences for d1x9sb_:

Sequence; same for both SEQRES and ATOM records:

>d1x9sb_ c.47.1.1 (B:) Thioredoxin {Escherichia coli [TaxId: 562]}
kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl

Timeline for d1x9sb_:

• d1x9sb_ first appeared in SCOP 1.71
  
• d1x9sb_ appears in SCOPe 2.03
  
• d1x9sb_ appears in SCOPe 2.05
  
• d1x9sb_ appears in the current release, SCOPe 2.08