Lineage for d1x9sb_ (1x9s B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876194Protein Thioredoxin [52835] (16 species)
  7. 2876219Species Escherichia coli [TaxId:562] [52836] (55 PDB entries)
    Uniprot P00274 ! Uniprot P00581
  8. 2876264Domain d1x9sb_: 1x9s B: [115007]
    Other proteins in same PDB: d1x9sa1, d1x9sa2
    protein/DNA complex; complexed with mg

Details for d1x9sb_

PDB Entry: 1x9s (more details), 2.7 Å

PDB Description: T7 DNA polymerase in complex with a primer/template DNA containing a disordered N-2 aminofluorene on the template, crystallized with dideoxy-CTP as the incoming nucleotide.
PDB Compounds: (B:) Thioredoxin 1

SCOPe Domain Sequences for d1x9sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9sb_ c.47.1.1 (B:) Thioredoxin {Escherichia coli [TaxId: 562]}
kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl

SCOPe Domain Coordinates for d1x9sb_:

Click to download the PDB-style file with coordinates for d1x9sb_.
(The format of our PDB-style files is described here.)

Timeline for d1x9sb_: