![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
![]() | Superfamily c.80.1: SIS domain [53697] (4 families) ![]() |
![]() | Family c.80.1.1: double-SIS domain [53698] (5 proteins) duplication: consists of two SIS domains related by pseudo dyad |
![]() | Protein Glucose-6-phosphate isomerase, conjectural [110726] (1 species) |
![]() | Species Pyrobaculum aerophilum [TaxId:13773] [110727] (4 PDB entries) Uniprot Q8ZWV0 |
![]() | Domain d1x9hb_: 1x9h B: [114996] complexed with f6r, gol, so4 |
PDB Entry: 1x9h (more details), 1.5 Å
SCOPe Domain Sequences for d1x9hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x9hb_ c.80.1.1 (B:) Glucose-6-phosphate isomerase, conjectural {Pyrobaculum aerophilum [TaxId: 13773]} sqllqdylnwenyilrrvdfptsyvvegevvrieamprlyisgmggsgvvadlirdfslt wnweveviavkdyflkardglliavsysgntietlytveyakrrripavaittggrlaqm gvptvivpkasapraalpqlltaalhvvakvygidvkipegleppnealihklveefqkr ptiiaaesmrgvayrvknefnenakiepsveilpeahhnwiegseravvaltsphipkeh qervkatveivggsiyavemhpkgvlsflrdvgiasvklaeirgvnplatpridalkrrl q
Timeline for d1x9hb_: