SCOPe 2.08: Domain d1x9hb_: 1x9h B:

Lineage for d1x9hb_ (1x9h B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (4 families)

5. Family c.80.1.1: double-SIS domain [53698] (5 proteins)
   duplication: consists of two SIS domains related by pseudo dyad

6. Protein Glucose-6-phosphate isomerase, conjectural [110726] (1 species)

7. Species Pyrobaculum aerophilum [TaxId:13773] [110727] (4 PDB entries)
   Uniprot Q8ZWV0

8. Domain d1x9hb_: 1x9h B: [114996]
   complexed with f6r, gol, so4

Details for d1x9hb_

PDB Entry: 1x9h, 1.5 Å

PDB Description: crystal structure of phosphoglucose/phosphomannose isomerase from pyrobaculum aerophilum in complex with fructose 6-phosphate

PDB Compounds: (B:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d1x9hb_:

Sequence; same for both SEQRES and ATOM records:

>d1x9hb_ c.80.1.1 (B:) Glucose-6-phosphate isomerase, conjectural {Pyrobaculum aerophilum [TaxId: 13773]}
sqllqdylnwenyilrrvdfptsyvvegevvrieamprlyisgmggsgvvadlirdfslt
wnweveviavkdyflkardglliavsysgntietlytveyakrrripavaittggrlaqm
gvptvivpkasapraalpqlltaalhvvakvygidvkipegleppnealihklveefqkr
ptiiaaesmrgvayrvknefnenakiepsveilpeahhnwiegseravvaltsphipkeh
qervkatveivggsiyavemhpkgvlsflrdvgiasvklaeirgvnplatpridalkrrl
q

Timeline for d1x9hb_:

• d1x9hb_ first appeared in SCOP 1.71
  
• d1x9hb_ appears in SCOPe 2.07