PDB entry 1x9h

View 1x9h on RCSB PDB site
Description: Crystal structure of phosphoglucose/phosphomannose isomerase from Pyrobaculum aerophilum in complex with fructose 6-phosphate
Class: isomerase
Keywords: enzyme, crenarchaeon, hyperthermophile, PGI superfamily, fructose 6-phosphate, ISOMERASE
Deposited on 2004-08-21, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-6-phosphate isomerase
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE1610
    Database cross-references and differences (RAF-indexed):
    • GB NP_559417 (Start-301)
    Domains in SCOPe 2.07: d1x9ha_
  • Chain 'B':
    Compound: Glucose-6-phosphate isomerase
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE1610
    Database cross-references and differences (RAF-indexed):
    • GB NP_559417 (Start-301)
    Domains in SCOPe 2.07: d1x9hb_
  • Heterogens: SO4, F6R, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x9hA (A:)
    msqllqdylnwenyilrrvdfptsyvvegevvrieamprlyisgmggsgvvadlirdfsl
    twnweveviavkdyflkardglliavsysgntietlytveyakrrripavaittggrlaq
    mgvptvivpkasapraalpqlltaalhvvakvygidvkipegleppnealihklveefqk
    rptiiaaesmrgvayrvknefnenakiepsveilpeahhnwiegseravvaltsphipke
    hqervkatveivggsiyavemhpkgvlsflrdvgiasvklaeirgvnplatpridalkrr
    lq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9hA (A:)
    sqllqdylnwenyilrrvdfptsyvvegevvrieamprlyisgmggsgvvadlirdfslt
    wnweveviavkdyflkardglliavsysgntietlytveyakrrripavaittggrlaqm
    gvptvivpkasapraalpqlltaalhvvakvygidvkipegleppnealihklveefqkr
    ptiiaaesmrgvayrvknefnenakiepsveilpeahhnwiegseravvaltsphipkeh
    qervkatveivggsiyavemhpkgvlsflrdvgiasvklaeirgvnplatpridalkrrl
    q
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x9hB (B:)
    msqllqdylnwenyilrrvdfptsyvvegevvrieamprlyisgmggsgvvadlirdfsl
    twnweveviavkdyflkardglliavsysgntietlytveyakrrripavaittggrlaq
    mgvptvivpkasapraalpqlltaalhvvakvygidvkipegleppnealihklveefqk
    rptiiaaesmrgvayrvknefnenakiepsveilpeahhnwiegseravvaltsphipke
    hqervkatveivggsiyavemhpkgvlsflrdvgiasvklaeirgvnplatpridalkrr
    lq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9hB (B:)
    sqllqdylnwenyilrrvdfptsyvvegevvrieamprlyisgmggsgvvadlirdfslt
    wnweveviavkdyflkardglliavsysgntietlytveyakrrripavaittggrlaqm
    gvptvivpkasapraalpqlltaalhvvakvygidvkipegleppnealihklveefqkr
    ptiiaaesmrgvayrvknefnenakiepsveilpeahhnwiegseravvaltsphipkeh
    qervkatveivggsiyavemhpkgvlsflrdvgiasvklaeirgvnplatpridalkrrl
    q