SCOPe 2.07: Domain d1x92b1: 1x92 B:1-195

Lineage for d1x92b1 (1x92 B:1-195)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (4 families)

5. Family c.80.1.3: mono-SIS domain [69599] (6 proteins)
   dimer of mono-domain subunits

6. Protein Phosphoheptose isomerase GmhA1 [110723] (4 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [117729] (1 PDB entry)
   Uniprot Q9HVZ0

8. Domain d1x92b1: 1x92 B:1-195 [114977]
   Other proteins in same PDB: d1x92b2
   complexed with m7p

Details for d1x92b1

PDB Entry: 1x92, 2.3 Å

PDB Description: crystal structure of pseudomonas aeruginosa phosphoheptose isomerase in complex with reaction product d-glycero-d-mannopyranose-7- phosphate

PDB Compounds: (B:) Phosphoheptose isomerase

SCOPe Domain Sequences for d1x92b1:

Sequence; same for both SEQRES and ATOM records:

>d1x92b1 c.80.1.3 (B:1-195) Phosphoheptose isomerase GmhA1 {Pseudomonas aeruginosa [TaxId: 287]}
mdmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagdaqh
fssellnrfererpslpavalttdsstitsiandysynevfskqiralgqpgdvllaist
sgnsanviqaiqaahdremlvvaltgrdgggmaslllpedveirvpskitariqevhlla
ihclcdlidrqlfgs

Timeline for d1x92b1:

• d1x92b1 first appeared in SCOP 1.71, called d1x92b_
  
• d1x92b1 appears in SCOPe 2.06
  
• d1x92b1 appears in the current release, SCOPe 2.08