Lineage for d1x92b_ (1x92 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 592149Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 592150Superfamily c.80.1: SIS domain [53697] (3 families) (S)
  5. 592225Family c.80.1.3: mono-SIS domain [69599] (5 proteins)
    dimer of mono-domain subunits
  6. 592241Protein Phosphoheptose isomerase GmhA1 [110723] (3 species)
  7. 592247Species Pseudomonas aeruginosa [TaxId:287] [117729] (1 PDB entry)
  8. 592249Domain d1x92b_: 1x92 B: [114977]
    complexed with m7p

Details for d1x92b_

PDB Entry: 1x92 (more details), 2.3 Å

PDB Description: crystal structure of pseudomonas aeruginosa phosphoheptose isomerase in complex with reaction product d-glycero-d-mannopyranose-7- phosphate

SCOP Domain Sequences for d1x92b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x92b_ c.80.1.3 (B:) Phosphoheptose isomerase GmhA1 {Pseudomonas aeruginosa}
ghmdmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagda
qhfssellnrfererpslpavalttdsstitsiandysynevfskqiralgqpgdvllai
stsgnsanviqaiqaahdremlvvaltgrdgggmaslllpedveirvpskitariqevhl
laihclcdlidrqlfgs

SCOP Domain Coordinates for d1x92b_:

Click to download the PDB-style file with coordinates for d1x92b_.
(The format of our PDB-style files is described here.)

Timeline for d1x92b_: