SCOPe 2.08: Domain d1wvka1: 1wvk A:10-86

Lineage for d1wvka1 (1wvk A:10-86)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.82: Expressed protein At2g23090/F21P24.15 [118358] (1 superfamily)
   not assigned; partly disordered

4. Superfamily g.82.1: Expressed protein At2g23090/F21P24.15 [118359] (1 family)
   putative zinc-finger protein

5. Family g.82.1.1: Expressed protein At2g23090/F21P24.15 [118360] (1 protein)

6. Protein Expressed protein At2g23090/F21P24.15 [118361] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118362] (1 PDB entry)
   Uniprot O64818 2-78

8. Domain d1wvka1: 1wvk A:10-86 [114919]
   Other proteins in same PDB: d1wvka2
   structural genomics target

Details for d1wvka1

PDB Entry: 1wvk

PDB Description: nmr solution structure of the partially disordered protein at2g23090 from arabidopsis thaliana

PDB Compounds: (A:) At2g23090/F21P24.15

SCOPe Domain Sequences for d1wvka1:

Sequence; same for both SEQRES and ATOM records:

>d1wvka1 g.82.1.1 (A:10-86) Expressed protein At2g23090/F21P24.15 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gggnaqksamaraknlekakaagkgsqleankkamsiqckvcmqtficttsevkcrehae
akhpkadvvacfphlkk

Timeline for d1wvka1:

• d1wvka1 first appeared in SCOP 1.71, called d1wvka_
  
• d1wvka1 appears in SCOPe 2.07