PDB entry 1wvk

View 1wvk on RCSB PDB site
Description: NMR Solution Structure of the Partially Disordered Protein At2g23090 from Arabidopsis thaliana
Class: structural genomics, unknown function
Keywords: Structural genomics, protein structure initiative, PSI, cell free, Center for Eukaryotic Structural Genomics, CESG, At2g23090.1, UNKNOWN FUNCTION
Deposited on 2004-12-16, released 2005-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: At2g23090/F21P24.15
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT2G23090
    Database cross-references and differences (RAF-indexed):
    • Uniprot O64818 (9-85)
      • expression tag (0-8)
    Domains in SCOPe 2.07: d1wvka1, d1wvka2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wvkA (A:)
    ghhhhhhlegggnaqksamaraknlekakaagkgsqleankkamsiqckvcmqtfictts
    evkcrehaeakhpkadvvacfphlkk