Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.31: ThiG-like [110399] (2 families) shares the common phosphate-binding site with other superfamilies |
Family c.1.31.1: ThiG-like [110400] (1 protein) Pfam PF05690 |
Protein Thiazole biosynthesis protein ThiG [110401] (2 species) |
Species Pseudomonas aeruginosa [TaxId:287] [117395] (1 PDB entry) Uniprot Q9I6B4 9-251 |
Domain d1wv2b_: 1wv2 B: [114911] Structural genomics target |
PDB Entry: 1wv2 (more details), 2.9 Å
SCOPe Domain Sequences for d1wv2b_:
Sequence, based on SEQRES records: (download)
>d1wv2b_ c.1.31.1 (B:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} tpfviagrtygsrllvgtgkykdldetrraieasgaeivtvavrrtnigqnpdepnlldv ippdrytilpntagcydaveavrtcrlarelldghnlvklevladqktlfpnvvetlkaa eqlvkdgfdvmvytsddpiiarqlaeigciavmplagligsglgicnpynlriileeakv pvlvdagvgtasdaaiamelgceavlmntaiahakdpvmmaeamkhaivagrlaylagrm prk
>d1wv2b_ c.1.31.1 (B:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} tpfviagrtygsrllvgtgkykdldetrraieasgaeivtvavrrytilpntagcydave avrtcrlarelldghnlvklevladqktlfpnvvetlkaaeqlvkdgfdvmvytsddpii arqlaeigciavmplagligsglgicnpynlriileeakvpvlvdagvgtasdaaiamel gceavlmntaiahakdpvmmaeamkhaivagrlaylagrmprk
Timeline for d1wv2b_: