Lineage for d1wv2a_ (1wv2 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090174Superfamily c.1.31: ThiG-like [110399] (2 families) (S)
    shares the common phosphate-binding site with other superfamilies
  5. 2090175Family c.1.31.1: ThiG-like [110400] (1 protein)
    Pfam PF05690
  6. 2090176Protein Thiazole biosynthesis protein ThiG [110401] (2 species)
  7. 2090184Species Pseudomonas aeruginosa [TaxId:287] [117395] (1 PDB entry)
    Uniprot Q9I6B4 9-251
  8. 2090185Domain d1wv2a_: 1wv2 A: [114910]
    Structural genomics target

Details for d1wv2a_

PDB Entry: 1wv2 (more details), 2.9 Å

PDB Description: Crystal structure of thiamine biosynthesis protein from Pseudomonas Aeruginosa
PDB Compounds: (A:) Thiazole biosynthesis protein thiG

SCOPe Domain Sequences for d1wv2a_:

Sequence, based on SEQRES records: (download)

>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]}
tpfviagrtygsrllvgtgkykdldetrraieasgaeivtvavrrtnigqnpdepnlldv
ippdrytilpntagcydaveavrtcrlarelldghnlvklevladqktlfpnvvetlkaa
eqlvkdgfdvmvytsddpiiarqlaeigciavmplagligsglgicnpynlriileeakv
pvlvdagvgtasdaaiamelgceavlmntaiahakdpvmmaeamkhaivagrlaylagrm
prk

Sequence, based on observed residues (ATOM records): (download)

>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]}
tpfviagrtygsrllvgtgkykdldetrraieasgaeivtvavrrtnippdrytilpnta
gcydaveavrtcrlarelldghnlvklevladqktlfpnvvetlkaaeqlvkdgfdvmvy
tsddpiiarqlaeigciavmplagligsglgicnpynlriileeakvpvlvdagvgtasd
aaiamelgceavlmntaiahakdpvmmaeamkhaivagrlaylagrmprk

SCOPe Domain Coordinates for d1wv2a_:

Click to download the PDB-style file with coordinates for d1wv2a_.
(The format of our PDB-style files is described here.)

Timeline for d1wv2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wv2b_