PDB entry 1wv2

View 1wv2 on RCSB PDB site
Description: Crystal structure of thiamine biosynthesis protein from Pseudomonas Aeruginosa
Class: biosynthetic protein
Keywords: Structural genomics, PROTEIN STRUCTURE INITIATIVE, PSI, New York SGX Research Center for Structural Genomics, NYSGXRC target T1779, thiamine biosynthesis, TIM barrel, BIOSYNTHETIC PROTEIN
Deposited on 2004-12-10, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiazole biosynthesis protein thiG
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wv2a_
  • Chain 'B':
    Compound: Thiazole biosynthesis protein thiG
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wv2b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wv2A (A:)
    msqasstdtpfviagrtygsrllvgtgkykdldetrraieasgaeivtvavrrtnigqnp
    depnlldvippdrytilpntagcydaveavrtcrlarelldghnlvklevladqktlfpn
    vvetlkaaeqlvkdgfdvmvytsddpiiarqlaeigciavmplagligsglgicnpynlr
    iileeakvpvlvdagvgtasdaaiamelgceavlmntaiahakdpvmmaeamkhaivagr
    laylagrmprklyasasspldglid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wv2A (A:)
    tpfviagrtygsrllvgtgkykdldetrraieasgaeivtvavrrtnippdrytilpnta
    gcydaveavrtcrlarelldghnlvklevladqktlfpnvvetlkaaeqlvkdgfdvmvy
    tsddpiiarqlaeigciavmplagligsglgicnpynlriileeakvpvlvdagvgtasd
    aaiamelgceavlmntaiahakdpvmmaeamkhaivagrlaylagrmprk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wv2B (B:)
    msqasstdtpfviagrtygsrllvgtgkykdldetrraieasgaeivtvavrrtnigqnp
    depnlldvippdrytilpntagcydaveavrtcrlarelldghnlvklevladqktlfpn
    vvetlkaaeqlvkdgfdvmvytsddpiiarqlaeigciavmplagligsglgicnpynlr
    iileeakvpvlvdagvgtasdaaiamelgceavlmntaiahakdpvmmaeamkhaivagr
    laylagrmprklyasasspldglid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wv2B (B:)
    tpfviagrtygsrllvgtgkykdldetrraieasgaeivtvavrrytilpntagcydave
    avrtcrlarelldghnlvklevladqktlfpnvvetlkaaeqlvkdgfdvmvytsddpii
    arqlaeigciavmplagligsglgicnpynlriileeakvpvlvdagvgtasdaaiamel
    gceavlmntaiahakdpvmmaeamkhaivagrlaylagrmprk