![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
![]() | Protein N-acylamino acid racemase [110372] (4 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [117382] (1 PDB entry) Uniprot Q838J7; EF0450; protein assignment by sequence similarity |
![]() | Domain d1wueb1: 1wue B:2127-2367 [114894] Other proteins in same PDB: d1wuea2, d1wuea3, d1wueb2, d1wueb3 Structural genomics target |
PDB Entry: 1wue (more details), 2.1 Å
SCOPe Domain Sequences for d1wueb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wueb1 c.1.11.2 (B:2127-2367) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]} trrkipvgislgiqedlpqllkqvqlavekgyqrvklkirpgydvepvalirqhfpnlpl mvdansaytladlpqlqrldhyqlamieqpfaaddfldhaqlqrelktricldenirslk dcqvalalgscrsinlkiprvggihealkiaafcqendllvwlggmfesgvgralnlqfa sqptfsfpgdisateryfyediitepfileqgtmtvpqglgigvtlsqtnllkysqyqki m
Timeline for d1wueb1: