SCOPe 2.08: Domain d1wueb1: 1wue B:2127-2367

Lineage for d1wueb1 (1wue B:2127-2367)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)

6. Protein N-acylamino acid racemase [110372] (4 species)

7. Species Enterococcus faecalis [TaxId:1351] [117382] (1 PDB entry)
   Uniprot Q838J7; EF0450; protein assignment by sequence similarity

8. Domain d1wueb1: 1wue B:2127-2367 [114894]
   Other proteins in same PDB: d1wuea2, d1wuea3, d1wueb2, d1wueb3
   Structural genomics target

Details for d1wueb1

PDB Entry: 1wue, 2.1 Å

PDB Description: crystal structure of protein gi:29375081, unknown member of enolase superfamily from enterococcus faecalis v583

PDB Compounds: (B:) mandelate racemase/muconate lactonizing enzyme family protein

SCOPe Domain Sequences for d1wueb1:

Sequence; same for both SEQRES and ATOM records:

>d1wueb1 c.1.11.2 (B:2127-2367) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]}
trrkipvgislgiqedlpqllkqvqlavekgyqrvklkirpgydvepvalirqhfpnlpl
mvdansaytladlpqlqrldhyqlamieqpfaaddfldhaqlqrelktricldenirslk
dcqvalalgscrsinlkiprvggihealkiaafcqendllvwlggmfesgvgralnlqfa
sqptfsfpgdisateryfyediitepfileqgtmtvpqglgigvtlsqtnllkysqyqki
m

Timeline for d1wueb1:

• d1wueb1 first appeared in SCOP 1.71
  
• d1wueb1 appears in SCOPe 2.07