Lineage for d1wueb2 (1wue B:2001-2126)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. Protein N-acylamino acid racemase [110937] (4 species)
  7. Species Enterococcus faecalis [TaxId:1351] [117925] (1 PDB entry)
    Uniprot Q838J7; EF0450; protein assignment by sequence similarity
  8. Domain d1wueb2: 1wue B:2001-2126 [114895]
    Other proteins in same PDB: d1wuea1, d1wuea3, d1wueb1, d1wueb3
    Structural genomics target

Details for d1wueb2

PDB Entry: 1wue (more details), 2.1 Å

PDB Description: crystal structure of protein gi:29375081, unknown member of enolase superfamily from enterococcus faecalis v583
PDB Compounds: (B:) mandelate racemase/muconate lactonizing enzyme family protein

SCOPe Domain Sequences for d1wueb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wueb2 d.54.1.1 (B:2001-2126) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]}
mniqsietyqvrlplktpfvtsygrleekafdlfvitdeqgnqgfgelvafeqpdyvqet
lvterfiiqqhliplllteaieqpqevstifeevkghwmgkaaletaiwdlyakrqqksl
teffgp

SCOPe Domain Coordinates for d1wueb2 are not available.

Timeline for d1wueb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wueb1, d1wueb3
View in 3D
Domains from other chains:
(mouse over for more information)
d1wuea1, d1wuea2, d1wuea3