![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (5 families) ![]() |
![]() | Family a.24.16.2: Family 1 bi-partite nucleotidyltransferase subunit [81740] (2 proteins) automatically mapped to Pfam PF08780 |
![]() | Protein Probable nucleotidyltransferase subunit TTHA0048 [116876] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [116877] (3 PDB entries) Uniprot Q5SM95 Structural genomics target |
![]() | Domain d1wtyb_: 1wty B: [114881] Structural genomics target |
PDB Entry: 1wty (more details), 2.2 Å
SCOPe Domain Sequences for d1wtyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wtyb_ a.24.16.2 (B:) Probable nucleotidyltransferase subunit TTHA0048 {Thermus thermophilus [TaxId: 274]} slaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraairg afqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrle
Timeline for d1wtyb_: