SCOPe 2.03: Domain d1wsxa_: 1wsx A:

Lineage for d1wsxa_ (1wsx A:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [118213] (5 PDB entries)
   Uniprot P97287 152-308

8. Domain d1wsxa_: 1wsx A: [114867]

Details for d1wsxa_

PDB Entry: 1wsx

PDB Description: solution structure of mcl-1

PDB Compounds: (A:) myeloid cell leukemia sequence 1

SCOPe Domain Sequences for d1wsxa_:

Sequence; same for both SEQRES and ATOM records:

>d1wsxa_ f.1.4.1 (A:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Mouse (Mus musculus) [TaxId: 10090]}
gplgseddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhe
tafqgmlrkldiknegdvksfsrvmvhvfkdgvtnwgrivtlisfgafvakhlksvnqes
fieplaetitdvlvrtkrdwlvkqrgwdgfveffhvqdlegg

Timeline for d1wsxa_:

• d1wsxa_ first appeared in SCOP 1.71
  
• d1wsxa_ appears in SCOPe 2.02
  
• d1wsxa_ appears in SCOPe 2.04
  
• d1wsxa_ appears in the current release, SCOPe 2.08, called d1wsxa1